Protein Info for DVU0963 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: GTP cyclohydrolase I family protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03139: 7-cyano-7-deazaguanine reductase
  • amino acids 27 to 139 (113 residues), 173.2 bits, E=7.4e-56
• PF14489: QueF
  • amino acids 62 to 139 (78 residues), 107.8 bits, E=1.3e-35

Best Hits

Swiss-Prot: 100% identical to QUEF_DESVV: NADPH-dependent 7-cyano-7-deazaguanine reductase (queF) from Desulfovibrio vulgaris subsp. vulgaris (strain DP4)

KEGG orthology group: K09457, 7-cyano-7-deazaguanine reductase [EC: 1.7.1.13] (inferred from 100% identity to dvl:Dvul_2025)

Predicted SEED Role

"NADPH dependent preQ0 reductase (EC 1.7.1.13)" (EC 1.7.1.13)

MetaCyc Pathways

• queuosine biosynthesis I (de novo) (3/4 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.7.1.13

Sequence Analysis Tools

See Q72DG6 at UniProt or InterPro

Protein Sequence (165 amino acids)

>DVU0963 GTP cyclohydrolase I family protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MTTRSTDQTEHLRALGQKTPYPAAGPSTDLLEAFPNRFPDRPYIVSIAFPEFTSLCPVTG
QPDFATIVVEYIPDQFCVESKSFKVYMFAFRDHQSFMETITNTILDDMTTKLQPLWCRVK
GLFTPRGGTQLHVFAERFKEVEPARAQALRDMVSEWKRENNRHGA