Protein Info for DVU0955 in Desulfovibrio vulgaris Hildenborough JW710

Name: alr
Annotation: alanine racemase (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00492: alanine racemase
  • amino acids 8 to 365 (358 residues), 251.8 bits, E=5e-79
• PF01168: Ala_racemase_N
  • amino acids 12 to 229 (218 residues), 192.1 bits, E=1.1e-60
• PF00842: Ala_racemase_C
  • amino acids 245 to 370 (126 residues), 133.7 bits, E=3.1e-43

Best Hits

Swiss-Prot: 100% identical to ALR_DESVH: Alanine racemase (alr) from Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303)

KEGG orthology group: K01775, alanine racemase [EC: 5.1.1.1] (inferred from 100% identity to dvl:Dvul_2031)

Predicted SEED Role

"Alanine racemase (EC 5.1.1.1)" in subsystem Alanine biosynthesis or Pyruvate Alanine Serine Interconversions (EC 5.1.1.1)

MetaCyc Pathways

• alanine racemization (1/1 steps found)
• L-alanine degradation I (1/2 steps found)
• anaerobic energy metabolism (invertebrates, cytosol) (4/7 steps found)
• ansatrienin biosynthesis (1/9 steps found)
• superpathway of anaerobic energy metabolism (invertebrates) (6/17 steps found)
• cyclosporin A biosynthesis (1/15 steps found)

KEGG Metabolic Maps

• Alanine and aspartate metabolism
• D-Alanine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.1.1.1

Sequence Analysis Tools

See Q72DH4 at UniProt or InterPro

Protein Sequence (376 amino acids)

>DVU0955 alanine racemase (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MPISYNKASVVVSLQSIIANYRRIRTVAQRPMPVIKSDAYGHGLEAVGMALEAEGARECA
VGTVGEGAKLRKAGFGADIVALLGALDREDAQLAASSGIIPTVLDIAGLERLAAQGTPER
PVRVALKFDTGMARLGFTEHDVSALCERLRTLPSVRPVMAVSHLAVADDPTQSAFTMAQG
AAFARIMAGLRSNFPDIMGSLSNSAATLAHPQLHWDVQRPGIALYGSNPLRGTALARHGE
GLLPAMSVSVPVLQVHPLPAGRSISYGRTYTATKDATVAIIAAGYADNYSRALSGRGVAV
AGGRRVPVLGRVCMQTTAIDVTDVPGIATGDRVWLLGGPGPATVSADELADLWGTISYEV
LCLLGMNPRRHDDSVE