Protein Info for DVU0951 in Desulfovibrio vulgaris Hildenborough JW710

Name: moeA-2
Annotation: molybdopterin biosynthesis MoeA protein, putative (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 472 PF03453: MoeA_N" amino acids 85 to 229 (145 residues), 138.9 bits, see alignment E=1.8e-44 TIGR00177: molybdenum cofactor synthesis domain" amino acids 239 to 374 (136 residues), 92.7 bits, see alignment E=1.1e-30 PF00994: MoCF_biosynth" amino acids 242 to 381 (140 residues), 104.1 bits, see alignment E=8.5e-34 PF03454: MoeA_C" amino acids 398 to 469 (72 residues), 57.9 bits, see alignment E=1.4e-19

Best Hits

KEGG orthology group: K03750, molybdopterin biosynthesis protein MoeA (inferred from 100% identity to dvl:Dvul_2035)

Predicted SEED Role

"Molybdopterin biosynthesis protein MoeA" in subsystem Molybdenum cofactor biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72DH8 at UniProt or InterPro

Protein Sequence (472 amino acids)

>DVU0951 molybdopterin biosynthesis MoeA protein, putative (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
VERLLWVAPLPWAGYGRDFDRQEGSMSMQQRFFRVLTVSELVALLRTCAPLGAECPTAGR
SDSLPIEDAASLDSSDAPTSLESSGSLDSLDGRVLAKAVVARENLPATHRAAMDGYAVRA
ADLFGASEGSPAYLDVVGHSAIDARPDVTLGPGQCLGIVTGGTLPEGADAVLMVEYAHDL
GGGAIEAHRPVAPWENVMLRAEDAEEGRVVLPAGTLLRPQEVGLLAALGETAPLVHRRPR
VAVISTGDELVPADATPRDGQIRDVNTHTLACLVRRAGAVPRCMGLVPDVLPALEAALRQ
GLETADVVLLSGGSSVGVRDLTVAALERIEGAELLCHGVAISPGKPLIVARVGEKLVWGL
PGQVTSAQVVMHVLGMPFLRHLAGWQDAFDMSRWPSRRAVLARNTATRQGREDYIRVRLD
PRPDDLPEAVPLFGKSGLLKTLVGSDGVVRIPAEVEGLERGALVDVLLFGER