Protein Info for DVU0947 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: membrane protein, putative (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 301 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details transmembrane" amino acids 41 to 59 (19 residues), see Phobius details amino acids 71 to 91 (21 residues), see Phobius details amino acids 97 to 118 (22 residues), see Phobius details amino acids 127 to 145 (19 residues), see Phobius details amino acids 155 to 175 (21 residues), see Phobius details amino acids 183 to 206 (24 residues), see Phobius details amino acids 217 to 241 (25 residues), see Phobius details amino acids 252 to 270 (19 residues), see Phobius details amino acids 276 to 294 (19 residues), see Phobius details PF00892: EamA" amino acids 8 to 142 (135 residues), 74 bits, see alignment E=6.8e-25 amino acids 158 to 293 (136 residues), 66 bits, see alignment E=2e-22

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvl:Dvul_2038)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72DI2 at UniProt or InterPro

Protein Sequence (301 amino acids)

>DVU0947 membrane protein, putative (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MPRSAKATGYLCALAATVIWSGNFIVARALADTVPPVTTSFLRWVTALVVILPFGLGAVR
RDMPLLRANLTYFIMAGITGVSVFNTFIYIAGRTTEAINMALIASSSPVWIIILSRILLG
EAVTLRRAAGVAVSLCGTLVLVTRGDFTRLASLRFAVGDLWMLAAALTFASYSVLLRKKP
EGISALGSLTTTFAIGVVGILPMLAWEWGHGAQLAVTPAVVGAVLYIGIGASLLAYLCWS
VAVERIGPAKSALVYYSLPLFSATEAALLLGETITLAHVASCALIVGGILIATMQRAPAA
K