Protein Info for DVU0945 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: sensor histidine kinase (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 810 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 215 to 240 (26 residues), see Phobius details PF11845: DUF3365" amino acids 40 to 202 (163 residues), 113 bits, see alignment E=3.4e-36 PF08448: PAS_4" amino acids 469 to 572 (104 residues), 27 bits, see alignment E=8.8e-10 PF00512: HisKA" amino acids 587 to 647 (61 residues), 54.6 bits, see alignment 1.9e-18 PF02518: HATPase_c" amino acids 693 to 797 (105 residues), 82.6 bits, see alignment E=5.8e-27

Best Hits

KEGG orthology group: K00936, [EC: 2.7.3.-] (inferred from 100% identity to dvl:Dvul_2040)

Predicted SEED Role

No annotation

Isozymes

Compare fitness of predicted isozymes for: 2.7.3.-

Use Curated BLAST to search for 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72DI4 at UniProt or InterPro

Protein Sequence (810 amino acids)

>DVU0945 sensor histidine kinase (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MHNRKSHTLEHKFLLSLGLAGLVLCVVFSFIFYVHMRGVVEEQVRDKAELVFAQIDAIQG
YVRETLRPSMFKTHPGEFFIEGMSSSFISRNIMERMGDKAVGHVYRRVAIGARNPASEAD
ELERSLIERFRAREDETQWAGTLNLRGTDHFVITRQVRFTAECMPCHGVPGDAPPELIRM
YGERGFGHKLDSIDGLDFVAFPVGSSEAQLKGVITSYFILFVLCATFFFATAFFVFRVLV
VRRLHDLAASFRKTLGFDGQSRALERLDGLQEGDEVEEIVERFEDVAHHLAEARNQLQAY
ADNLRDMVDARTEALSQEAAERRADVSLFVQLLEDMRGTHTRERLWRGALPQIAKRFGTR
RVGYVCTFVSHNHYVWPSNEPLPELPEPLTPLLTEGRVHVFGTRVFVPVEAQDGATEGLL
CLEWATPEEAARQNMDVLRALGRQLGTVAENISALDRMMRQMDLLQAVFDGVGDPLALLD
AKGRLVIANDGARRLATELGGTDGYGNLLAPLLGTSCETEIEAVAHGGAVLHREVQLDDG
RSFSVQLYPLPRVEERPGRVAAYIHETTAERRMLARVNQSERMATVGKLSAGLAHEINNP
LGVILCYAELLRQGATAEQQDDLGIILRHTRQAQKVLRDLLDFARPKAFEGVLTDAAGVA
RRMAEVFGPQAAHRGGRVQVEAEDGLPPARIGEQALEQILSNLLLNAIDALTGEDGLIRI
RLRSHGLNVRIDVEDNGLGVETDALQRVFDPFYTTKETGTGLGLSVVYGIVTDAGGTAEV
LQSHELGGAVFRVTLPAGTAPEAGATEEKV