Protein Info for DVU0942 in Desulfovibrio vulgaris Hildenborough JW710

Name: fur
Annotation: ferric uptake regulator (Dmitry Rodionov)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 144 PF01475: FUR" amino acids 15 to 134 (120 residues), 126 bits, see alignment E=4.6e-41

Best Hits

Swiss-Prot: 37% identical to FUR_CAMJE: Ferric uptake regulation protein (fur) from Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)

KEGG orthology group: K03711, Fur family transcriptional regulator, ferric uptake regulator (inferred from 100% identity to dvu:DVU0942)

Predicted SEED Role

"Ferric uptake regulation protein FUR" in subsystem Bacterial RNA-metabolizing Zn-dependent hydrolases or Iron acquisition in Vibrio or Oxidative stress or Transport of Iron

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72DI7 at UniProt or InterPro

Protein Sequence (144 amino acids)

>DVU0942 ferric uptake regulator (Dmitry Rodionov) (Desulfovibrio vulgaris Hildenborough JW710)
MKEPIAVFQDYIARNSLKVTPQRMLIVDVFLKVGGHLTTEEVYERVKAVDPSVGQATVYR
TMKLLCDSGLAKEVHFGDGVARYEQKYGSKHHDHLICERCGANIEVLDDDIERLQEELAR
RHGYVLTSHRMYLYGICASCRERR