Protein Info for DVU0930 in Desulfovibrio vulgaris Hildenborough JW710

Name: proB
Annotation: glutamate 5-kinase (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00696: AA_kinase
  • amino acids 16 to 242 (227 residues), 131.6 bits, E=4e-42
• TIGR01027: glutamate 5-kinase
  • amino acids 17 to 375 (359 residues), 398.8 bits, E=1.2e-123
• PF01472: PUA
  • amino acids 286 to 360 (75 residues), 62.3 bits, E=3.5e-21

Best Hits

Swiss-Prot: 100% identical to PROB_DESVH: Glutamate 5-kinase (proB) from Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303)

KEGG orthology group: K00931, glutamate 5-kinase [EC: 2.7.2.11] (inferred from 100% identity to dvl:Dvul_2055)

Predicted SEED Role

"Glutamate 5-kinase (EC 2.7.2.11) / RNA-binding C-terminal domain PUA" in subsystem Proline Synthesis (EC 2.7.2.11)

MetaCyc Pathways

• L-proline biosynthesis I (from L-glutamate) (4/4 steps found)
• L-ornithine biosynthesis II (2/3 steps found)
• L-citrulline biosynthesis (5/8 steps found)
• superpathway of L-citrulline metabolism (7/12 steps found)
• L-N^δ-acetylornithine biosynthesis (3/7 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Urea cycle and metabolism of amino groups

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.2.11

Sequence Analysis Tools

See Q72DJ9 at UniProt or InterPro

Protein Sequence (380 amino acids)

>DVU0930 glutamate 5-kinase (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MEWTEERAAALREARCVVVKVGSAVLTTETGVNLAVIDSLAAQLSALQESGKRVVLVSSG
AVAAGRSALRDCCEIAGMPHKQAASAVGQSRLMHHYDEAFARYGHLSAQVLLTRDDLRNR
ERFLNARNTFQALLDWGVIPVVNENDTVAVQELKFGDNDCLASLLLNVVEGDLYVNLTSA
SGVYADNPQTNPEAGILPCIEDVHTLDLDVMCGGKTSVGTGGMYSKLLAASRAAQLGVPT
LILPGREPRILERAFSGEPVGTWVRPEARVVSRRKYWLAYQSEPSGTVTVDEGAARALLQ
QGGSLLPGGVCDVSGAFEPGALVRIAGPDGTVIAVGLSNYGDRDLVRIKGHRRHEVAAIL
GDAHFPEVVHRDNMLLDAVV