Protein Info for DVU0929 in Desulfovibrio vulgaris Hildenborough JW710

Name: obg
Annotation: GTP-binding protein, GTP1/OBG family (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 366 TIGR02729: Obg family GTPase CgtA" amino acids 3 to 333 (331 residues), 447.5 bits, see alignment E=1.3e-138 PF01018: GTP1_OBG" amino acids 4 to 161 (158 residues), 201.6 bits, see alignment E=5.4e-64 PF01926: MMR_HSR1" amino acids 165 to 289 (125 residues), 72.1 bits, see alignment E=4.1e-24

Best Hits

Swiss-Prot: 100% identical to OBG_DESVH: GTPase Obg (obg) from Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303)

KEGG orthology group: K03979, GTP-binding protein (inferred from 100% identity to dvl:Dvul_2056)

Predicted SEED Role

"GTP-binding protein Obg"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72DK0 at UniProt or InterPro

Protein Sequence (366 amino acids)

>DVU0929 GTP-binding protein, GTP1/OBG family (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MRFVDEATINVRAGKGGNGCLSFRREKFIPRGGPDGGNGGDGGSVILRPTNRLLSLYDFR
LQRNYEARNGQSGMGSQCDGRKGEDLVLELPLGTLVFEVDDEGHEQMIADLSDPDGVFVV
ARGGRGGKGNEHFKSSTMRAPRFAQKGEPGEERRLRLELKILADAGLLGLPNAGKSTFIS
RISAARPKIAAYPFTTLTPNLGVMIDEVDPDRRMVIADIPGLIEGAHTGQGLGHRFLKHV
ERTRFLVHILSIEDIDPENPWTGFDLINEELARFDEVLREREQIEVVNKIDLRTPEEVDA
LRQQAAQQGRRIFFISAMHGEGIEEVVDAMWRLRDTIDMHEPLVHLQEVEEEDEEFEDIE
VVYTRE