Protein Info for DVU0918 in Desulfovibrio vulgaris Hildenborough JW710

Name: atpB
Annotation: ATP synthase F0, A subunit (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 233 transmembrane" amino acids 32 to 51 (20 residues), see Phobius details amino acids 86 to 106 (21 residues), see Phobius details amino acids 114 to 132 (19 residues), see Phobius details amino acids 150 to 165 (16 residues), see Phobius details amino acids 185 to 206 (22 residues), see Phobius details amino acids 211 to 229 (19 residues), see Phobius details TIGR01131: ATP synthase F0, A subunit" amino acids 29 to 227 (199 residues), 129.2 bits, see alignment E=1.2e-41 PF00119: ATP-synt_A" amino acids 32 to 226 (195 residues), 182.1 bits, see alignment E=7.1e-58

Best Hits

Swiss-Prot: 100% identical to ATP6_DESVV: ATP synthase subunit a (atpB) from Desulfovibrio vulgaris subsp. vulgaris (strain DP4)

KEGG orthology group: K02108, F-type H+-transporting ATPase subunit a [EC: 3.6.3.14] (inferred from 100% identity to dvl:Dvul_2066)

Predicted SEED Role

"ATP synthase F0 sector subunit a (EC 3.6.3.14)" (EC 3.6.3.14)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.14

Use Curated BLAST to search for 3.6.3.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72DL1 at UniProt or InterPro

Protein Sequence (233 amino acids)

>DVU0918 ATP synthase F0, A subunit (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MAGGLPHPVLWSTLLNVDTITIGGATVEFKHVFYTWCAMAILFSLGLIVRSSLKVVPGAL
QNVFEVVIGGLEDFVVGNIGEDGRKVFPLLGGIFLFILFQNLLGLVPGCDAPTANVNTNA
AMALFVFGYYNYQGLKRWGPGYIKHFMGPMTWLTPLMLPLEIISHCARPLSLTLRLFGNI
RGEEIVMVLFFLMAPIVGTLPVYFLFLLGKVLQAFIFFMLTMVYLKGAFEHAH