Protein Info for DVU0916 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: AT-rich DNA-binding protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 214 PF06971: Put_DNA-bind_N" amino acids 8 to 55 (48 residues), 76.3 bits, see alignment 1.5e-25 PF02629: CoA_binding" amino acids 85 to 181 (97 residues), 78.5 bits, see alignment E=5.3e-26

Best Hits

Swiss-Prot: 69% identical to REX_DESMR: Redox-sensing transcriptional repressor Rex (rex) from Desulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1)

KEGG orthology group: K01926, AT-rich DNA-binding protein (inferred from 100% identity to dvl:Dvul_2068)

Predicted SEED Role

"Redox-sensitive transcriptional regulator (AT-rich DNA-binding protein)" in subsystem Oxidative stress

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72DL3 at UniProt or InterPro

Protein Sequence (214 amino acids)

>DVU0916 AT-rich DNA-binding protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MTNIKSEHIPRATIQRLAVYVQVLENLQREGVEVISSEPLAKACNVNASQIRKDLAYFGE
FGVRGVGYYVKSLIESITSALGVNREWRTVLVGVGNLGRALLNHKEFKLRGFHIVGAFDC
DPFKIGEEISGLEVICTKRLKERVADLNVEIGIITTPPERAQRAANHLVDAGIKGILNYA
PARISVPDDVFVEYVDFFHHLYALSFNITFSRNK