Protein Info for DVU0908 in Desulfovibrio vulgaris Hildenborough JW710

Updated annotation (from data): ATP-dependent reduction of co(II)balamin
Rationale: Important for fitness in most defined media. Semi-automated annotation based on the auxotrophic phenotype and a hit to HMM PF14574.
Original annotation: iron-sulfur cluster-binding protein, putative (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 543 PF00111: Fer2" amino acids 41 to 94 (54 residues), 22.7 bits, see alignment 1.2e-08 PF17651: Raco_middle" amino acids 123 to 191 (69 residues), 45 bits, see alignment E=1.4e-15 PF14574: RACo_C_ter" amino acids 298 to 541 (244 residues), 138.1 bits, see alignment E=4.5e-44

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvu:DVU0908)

Predicted SEED Role

"iron-sulfur cluster-binding protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72DM1 at UniProt or InterPro

Protein Sequence (543 amino acids)

>DVU0908 ATP-dependent reduction of co(II)balamin (Desulfovibrio vulgaris Hildenborough JW710)
MQPHPETTPVTSCTIIDATDRSIRQTLGETSTLARLIWVDAGLASPPLCSGLARCGRCRV
RITEAAPAPHEDDREFFSAEDISAGWRLACRHAPAHGMVVHVPLPVMPHRHASRPKHPGP
FRLAVDLGTTSLQWSLLAPDGTVAAQGSETNPQMGAGSDVMSRIAMARSDKGRGRLRELV
LQALRRIVADVEGTPATADAVPPAGSGDEPTTACGYESRVEELCVAGNTAMTAILADESV
EGLASAPYRLEMRGGTALALPGLPPAWIPPLPAPFVGGDLSAGYLAVLTDHAPAFPFVLA
DLGTNGEFVLALSPERTLVTSVALGPALEGIGLTFGTVAQRGAITSFTLTPGGLVPYVLD
GGEADGISGTGYISLVHALLRAGLLDVDGRFIQSPSSPLAARMARSIVSHRGEPCLPLAR
GLYLAARDIEEILKVKAAFSLAFERLLATAQMPSHALSGIHLAGALGQHALPADLEGLGF
IPPGSGGRTRAVGNTSLRGAELLLTSPPLRDTLNTWREGCTVVDLTAAPDFSAAFLRHMH
FHF