Protein Info for DVU0866 in Desulfovibrio vulgaris Hildenborough JW710

Name: dxr
Annotation: 1-deoxy-D-xylulose 5-phosphate reductoisomerase (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 408 TIGR00243: 1-deoxy-D-xylulose 5-phosphate reductoisomerase" amino acids 20 to 397 (378 residues), 447.9 bits, see alignment E=1.4e-138 PF02670: DXP_reductoisom" amino acids 21 to 148 (128 residues), 137.2 bits, see alignment E=8.1e-44 PF08436: DXP_redisom_C" amino acids 162 to 245 (84 residues), 132.3 bits, see alignment E=8.6e-43 PF13288: DXPR_C" amino acids 277 to 393 (117 residues), 135.1 bits, see alignment E=2.1e-43

Best Hits

Swiss-Prot: 100% identical to DXR_DESVH: 1-deoxy-D-xylulose 5-phosphate reductoisomerase (dxr) from Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303)

KEGG orthology group: K00099, 1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC: 1.1.1.267] (inferred from 100% identity to dvu:DVU0866)

Predicted SEED Role

"1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC 1.1.1.267)" in subsystem Isoprenoid Biosynthesis or polyprenyl synthesis (EC 1.1.1.267)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.267

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72DR3 at UniProt or InterPro

Protein Sequence (408 amino acids)

>DVU0866 1-deoxy-D-xylulose 5-phosphate reductoisomerase (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MIRYISAMPSPEWEHETPRTLALLGSTGSIGTSALRVVEAHPHRFKVVALAGARNVEKLA
AQAARWRPEHLGVLDATGAAKLRDLLPAGYAPHIHIGPEGYATMATLPEAGTVLSAQVGA
AGLRATEAAARHGKVICLANKESLVLAGDIIRRHCAGSGAVILPVDSEHNAIFQALQGHD
PASVRRIILTASGGPFRGRSRDDLAAVSCRDALAHPNWNMGAKISIDSATLMNKGLEVIE
ACHLYGVGIDDVGVVVHPQSIVHSLVEYEDGSQIAHLGTPDMRIAIAYCLTWPGVVDAGV
PRLDLVKAGSLTFEEPDLHSFPCLELARRAYREGRGMPVVLNAANEVAVSLFLSDRIRFL
DIPDIIARALDMHDGTTPHDIEGIEALDEATRRTVYERAGHSNTDGMA