Protein Info for DVU0865 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: membrane-associated zinc metalloprotease, putative (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 354 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details transmembrane" amino acids 91 to 114 (24 residues), see Phobius details amino acids 277 to 296 (20 residues), see Phobius details amino acids 298 to 298 (1 residues), see Phobius details amino acids 300 to 316 (17 residues), see Phobius details amino acids 328 to 349 (22 residues), see Phobius details PF02163: Peptidase_M50" amino acids 7 to 339 (333 residues), 220.1 bits, see alignment E=4.7e-69 PF00595: PDZ" amino acids 128 to 177 (50 residues), 36.5 bits, see alignment 1.1e-12 TIGR00054: RIP metalloprotease RseP" amino acids 128 to 352 (225 residues), 156.4 bits, see alignment E=5.5e-50 PF13180: PDZ_2" amino acids 128 to 189 (62 residues), 32.7 bits, see alignment E=1.5e-11 PF17820: PDZ_6" amino acids 128 to 180 (53 residues), 48 bits, see alignment 1.7e-16

Best Hits

KEGG orthology group: K11749, regulator of sigma E protease [EC: 3.4.24.-] (inferred from 100% identity to dvl:Dvul_2117)

Predicted SEED Role

No annotation

Isozymes

Compare fitness of predicted isozymes for: 3.4.24.-

Use Curated BLAST to search for 3.4.24.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72DR4 at UniProt or InterPro

Protein Sequence (354 amino acids)

>DVU0865 membrane-associated zinc metalloprotease, putative (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MSSFFSVLLVLGGLIFFHELGHYLAARVLGIGVHTFSLGFGPRIFGWRSGQTDYRLSLIP
LGGYVSLAGESDDEIPEGFTKGQMFSARPAWHRLIVIAAGPVFNLLLAWFIYWGLTFVHG
QFIVLPEVGKVLEGGPAAAAGVQSGDRIVAIDGVSIERWDQVSDAIAASKGAPVTLSLTR
NEGQHELRIVPEHRTRKTIFGDEEDAFLIGIQASGATMTLPQTPVEAAVTGARQTWTMIA
MTGKGVVKLFERVVPLDTVGGPIMIAQMVSREAKDSGITGVLALAALISINLGLLNLLPI
PVLDGGHIIFLGLEMLFRRPVPQKVQEVTTRMGLVLLLGLMFLATYNDIVRIGQ