Protein Info for DVU0863 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: flagellar hook-associated protein 2, putative (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 575 PF02465: FliD_N" amino acids 17 to 111 (95 residues), 77 bits, see alignment E=1.4e-25 PF07195: FliD_C" amino acids 221 to 558 (338 residues), 126.8 bits, see alignment E=9.8e-41

Best Hits

KEGG orthology group: K02407, flagellar hook-associated protein 2 (inferred from 100% identity to dvu:DVU0863)

Predicted SEED Role

"Flagellar hook-associated protein FliD" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72DR6 at UniProt or InterPro

Protein Sequence (575 amino acids)

>DVU0863 flagellar hook-associated protein 2, putative (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MADYLSGSINFTGLGGGVDFAQVIDGLKKIEQVPMNRLTLWKADWQRRKDAFGDLRTELA
TFKNVVDGMDTLEEFLVKTASSSNAAVASATTSSAALEGTYRIEVNKLASNGIWTFNDTF
ADKTQQVNTSTTDQSFVYTYKGTTRTMTVPPGTTLDGLKNIINNDPQNPGVRASFVQNGN
AWTFQMHGMDLGSEASLTIDASTNLSKLPGNDPTKWQTQQATDAEFRVNGWPATGWLKST
SNTVSNVIEGLNISLKDVGTTQLTVATDIEKIKEKITAFVDGMNAVRSKITEQTKVDSNK
ATISADKSASLFQAQKGSILTGNYGVQLISSRLKTAIADKSTGFEYQYKDGNINRGDIYS
SLAQIGILTNAEEGNPNYGLLTIDQEKLDAALKNNPTAVAELFAADGIGVSDSPDFSYQS
KVNGVTKAGIYDVSYEVDASGKIVNAVIDGRPAKVDDASHTLTSMDGNSRGLLLQVDNLA
PGSYSSRVRIKQGKAADIDGMLTDMLGKNGTLAVLENNYTDIMDDIDKKIESETSRIEKW
ERTMRNQFATLSATLARYDQLNQSLQSQITQLSKQ