Protein Info for DVU0855 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: radical SAM domain protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 393 TIGR04545: heme b synthase" amino acids 48 to 386 (339 residues), 663.5 bits, see alignment E=7.2e-204 PF04055: Radical_SAM" amino acids 52 to 208 (157 residues), 98.8 bits, see alignment E=6.2e-32 PF13353: Fer4_12" amino acids 55 to 156 (102 residues), 28.5 bits, see alignment E=2.7e-10 TIGR04085: radical SAM additional 4Fe4S-binding SPASM domain" amino acids 296 to 382 (87 residues), 40.2 bits, see alignment E=3.5e-14 PF13186: SPASM" amino acids 296 to 355 (60 residues), 36.8 bits, see alignment E=5.8e-13

Best Hits

KEGG orthology group: None (inferred from 96% identity to dvl:Dvul_2128)

Predicted SEED Role

"Radical SAM domain heme biosynthesis protein" in subsystem Heme biosynthesis orphans

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72DS4 at UniProt or InterPro

Protein Sequence (393 amino acids)

>DVU0855 radical SAM domain protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MDDIKTKVGHPGGPPAGHPGGHPGGGMGAHPTAHGPRTLEDGSPTCKLIAWEVTRSCNLA
CKHCRAEAHMEPYPGEFSTDEAKALIDTFPDVGNPIIIFTGGDPMMRGDVYELIAYATDK
GLRCVMSPNGTLITPEHAQRMKASGVQRCSISIDGPDAASHDAFRGVPGAFEQSMRGIGY
LRDAGIEFQINTTVTRDNLHSFKDIFKLCERIGAVAWHIFLLVPTGRAAGLSDQVISAAE
YEEVLNWFYDFRKTTSMHLKATCAPHYYRIMRQRAKEEGVSVTPDNFGMDAMTRGCLGGT
GFCFISHTGQVQPCGYLELDCGNVRNTPFPEIWRKSEHFRQFRTQEEYTGKCGPCEYHKV
CGGCRARAYNMSGDHMAEEPLCSYKPRRMTPCR