Protein Info for DVU0854 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: NirD protein, putative (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 176 PF13404: HTH_AsnC-type" amino acids 29 to 73 (45 residues), 27.9 bits, see alignment E=1.6e-10 PF17805: AsnC_trans_reg2" amino acids 89 to 168 (80 residues), 81.2 bits, see alignment E=4.9e-27

Best Hits

Swiss-Prot: 39% identical to NIRD_PSEST: Protein NirD (nirD) from Pseudomonas stutzeri

KEGG orthology group: None (inferred from 99% identity to dvl:Dvul_2129)

Predicted SEED Role

"Heme biosynthesis protein related to NirD and NirG" in subsystem Heme biosynthesis orphans

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72DS5 at UniProt or InterPro

Protein Sequence (176 amino acids)

>DVU0854 NirD protein, putative (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MTEAHNACCHPSGTAAGHHGAGKASTDMMDAVDRRLLDIIQTGFPIEPRPYAVLGETLGI
TECEALARVRALRERKVIRRLGANFDSWKLGFRSTLCAAKVPEDRIDAFVAEVNRHVNVT
HNYLRNHEYNIWFTCICPSWEQVCSLLDGITERTGIPILNLPATKLYKIRVDFRMD