Protein Info for DVU0840 in Desulfovibrio vulgaris Hildenborough JW710

Name: ffh
Annotation: signal recognition particle protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 508 TIGR00959: signal recognition particle protein" amino acids 2 to 428 (427 residues), 602.9 bits, see alignment E=1.6e-185 PF02881: SRP54_N" amino acids 5 to 82 (78 residues), 83.1 bits, see alignment E=2e-27 PF00448: SRP54" amino acids 101 to 295 (195 residues), 236.9 bits, see alignment E=2.3e-74 PF02978: SRP_SPB" amino acids 309 to 434 (126 residues), 156.2 bits, see alignment E=8.3e-50

Best Hits

Swiss-Prot: 55% identical to SRP54_BACSU: Signal recognition particle protein (ffh) from Bacillus subtilis (strain 168)

KEGG orthology group: K03106, signal recognition particle subunit SRP54 (inferred from 100% identity to dvl:Dvul_2141)

Predicted SEED Role

"Signal recognition particle, subunit Ffh SRP54 (TC 3.A.5.1.1)" in subsystem Two cell division clusters relating to chromosome partitioning or Universal GTPases (TC 3.A.5.1.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72DT9 at UniProt or InterPro

Protein Sequence (508 amino acids)

>DVU0840 signal recognition particle protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MFDSLSDRLTQAFRKFSGQSQLDENNIQEGLREVRLALLEADVNFKVVKDFIDRVKERCL
GQDVLKSLTPAQQVVKVVHDELVELLGGGTTELDLRGAQPGVIMMVGLQGSGKTTSSAKI
ANLLRKRKMRPYLVPVDVYRPAAIDQLVTLARQLDIPYYQSTPDMKPLDIVRAALADAKE
KQCTAVLLDTAGRLHVDEALMDELAALKATFAPQEILFVADAMTGQDAVTVADAFNEKLG
ITGVVLTKMDGDARGGAALSIKSVTGASVKYVGIGEKLSDIEVFHPDRVAGRILGMGDML
TLIEKAQSTIEADEAEALTKKFQRASFDLEDFRTQMRRMKKLGSLEGILKMIPGMGALRD
KLGQMSVPEKDMARIEAIISSMTMKERRNPDVINGSRRARIAKGSGTTVQEVNQLLRNFE
QMREMMKRVMNMGKPGGGRMPRIPGMGGMGGMGGGMGGLGGLGGLGGLGGLRGGMPGMGG
LPGMGGLPGGSSATKKKKQRDKKKRKKR