Protein Info for DVU0837 in Desulfovibrio vulgaris Hildenborough JW710

Name: rimM
Annotation: 16S rRNA processing protein RimM (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 176 TIGR02273: 16S rRNA processing protein RimM" amino acids 7 to 169 (163 residues), 115.3 bits, see alignment E=9.6e-38 PF01782: RimM" amino acids 9 to 88 (80 residues), 72.1 bits, see alignment E=5.7e-24 PF05239: PRC" amino acids 95 to 169 (75 residues), 24.5 bits, see alignment E=3.4e-09 PF24986: PRC_RimM" amino acids 101 to 169 (69 residues), 41.7 bits, see alignment E=1.1e-14

Best Hits

Swiss-Prot: 100% identical to RIMM_DESVH: Ribosome maturation factor RimM (rimM) from Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303)

KEGG orthology group: K02860, 16S rRNA processing protein RimM (inferred from 100% identity to dvl:Dvul_2144)

Predicted SEED Role

"16S rRNA processing protein RimM" in subsystem Ribosome biogenesis bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72DU2 at UniProt or InterPro

Protein Sequence (176 amino acids)

>DVU0837 16S rRNA processing protein RimM (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MEASRFIEIGLLTRPHGLKGEVCVDYYADSPFLLEGTVYLKAGRAAPRPVKVQSMRMHKG
RPLVIFEGVNDRTAAELLRGHVMLVPEDTLPELDEDEVYLFELEGISVVIDESGEHLGVI
ERIDTDAYQEIWVIRTPQGKEVLFPAAAPFVLDIDLDSRTARIAPPPGLLDIYLSD