Protein Info for DVU0829 in Desulfovibrio vulgaris Hildenborough JW710

Name: ptsI
Annotation: phosphoenolpyruvate-protein phosphotransferase (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 590 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details TIGR01417: phosphoenolpyruvate-protein phosphotransferase" amino acids 6 to 567 (562 residues), 548 bits, see alignment E=1.2e-168 PF05524: PEP-utilisers_N" amino acids 8 to 129 (122 residues), 108.1 bits, see alignment E=5.1e-35 PF00391: PEP-utilizers" amino acids 156 to 227 (72 residues), 71.6 bits, see alignment E=4.8e-24 PF02896: PEP-utilizers_C" amino acids 256 to 543 (288 residues), 360.2 bits, see alignment E=1.2e-111

Best Hits

Swiss-Prot: 38% identical to PT1_SALTY: Phosphoenolpyruvate-protein phosphotransferase (ptsI) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K08483, phosphotransferase system, enzyme I, PtsI [EC: 2.7.3.9] (inferred from 100% identity to dvu:DVU0829)

MetaCyc: 38% identical to PTS enzyme I (Escherichia coli K-12 substr. MG1655)
Phosphoenolpyruvate--protein phosphotransferase. [EC: 2.7.3.9]

Predicted SEED Role

"Phosphoenolpyruvate-protein phosphotransferase of PTS system (EC 2.7.3.9)" in subsystem Fructose and Mannose Inducible PTS or Fructose utilization or Mannitol Utilization (EC 2.7.3.9)

Isozymes

Compare fitness of predicted isozymes for: 2.7.3.9

Use Curated BLAST to search for 2.7.3.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72DV0 at UniProt or InterPro

Protein Sequence (590 amino acids)

>DVU0829 phosphoenolpyruvate-protein phosphotransferase (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MARGILYGIAVSSGISIGKAFFMDRSRQSAAHDIIQPGAAESEVARLDEAAAQVASDLDR
ARAQVPADLRDHAAIIDSHRMICRDPKLMGDAARRIREQNISAPWALEQAVDAIAQAFRA
IDDPYIRERVQDVRAVAERILSRLAGNARELKSTGERMVLLAHDLTPADTIELQVSRIMS
FATAEGGKTSHTGILARSLQIPAVVGVSGLEEATADGDLVIIDALRGRILIDPDEHELAE
YTELKYQFESYQRSIRRQSTLPAETLDGYRIEVQSNIELLEEVPQVLDSGADGVGLYRTE
YAFLARRQPPSEQDLCDEYSQVAALMSPRQVVFRTLDVGADKMLREQVRMEEPNPALGLR
AIRFCLRHQDVFRTQLRAILRASVHGNVALLFPMISGIQELRQARHILQEVRQELDAEGI
PHAPDMPVGIMVELPSAVLIADALAHEVDFFSIGTNDLIQYSLGIDRGNRHVSYLYQPLH
PAIVRSIKLVVDSAHRAGISVSVCGEVASDPFCLPILMGMQIDSISIAPQAVPGIKHIIR
KTNMEECKTLTRDVLNATTVSTINRMVKETIYNRFPEELTFFSSMLDTDD