Protein Info for DVU0825 in Desulfovibrio vulgaris Hildenborough JW710

Name: secA
Annotation: preprotein translocase, SecA subunit (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 833 PF07517: SecA_DEAD" amino acids 7 to 383 (377 residues), 440.3 bits, see alignment E=9.8e-136 TIGR00963: preprotein translocase, SecA subunit" amino acids 28 to 498 (471 residues), 783.6 bits, see alignment E=1.1e-239 PF00270: DEAD" amino acids 99 to 216 (118 residues), 27.2 bits, see alignment E=9.1e-10 PF01043: SecA_PP_bind" amino acids 232 to 340 (109 residues), 149.6 bits, see alignment E=1.4e-47 PF21090: P-loop_SecA" amino acids 399 to 499 (101 residues), 159 bits, see alignment E=3.9e-50 amino acids 499 to 568 (70 residues), 123.9 bits, see alignment E=2.1e-39 PF07516: SecA_SW" amino acids 570 to 773 (204 residues), 201.9 bits, see alignment E=3.7e-63 PF02810: SEC-C" amino acids 815 to 832 (18 residues), 38.6 bits, see alignment (E = 2.4e-13)

Best Hits

Swiss-Prot: 100% identical to SECA_DESVH: Protein translocase subunit SecA (secA) from Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303)

KEGG orthology group: K03070, preprotein translocase subunit SecA (inferred from 100% identity to dvu:DVU0825)

Predicted SEED Role

"Protein export cytoplasm protein SecA ATPase RNA helicase (TC 3.A.5.1.1)" (TC 3.A.5.1.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72DV4 at UniProt or InterPro

Protein Sequence (833 amino acids)

>DVU0825 preprotein translocase, SecA subunit (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MLGFLFKKVFGSKNDRYIKRLRPIVAAINALEPQMQSLRDEDFPVRIAEYRQQVEEGRKL
DDMLPEVFALVREAGKRVFNMRHFDVQLVGGMALHHGKIAEMKTGEGKTLVATLPVVLNA
LTGKGVHVVTVNDYLAKRDAAWMGQLYNFLGLSVGVIVHGLDDEQRKAAYGADITYGTNN
EFGFDYLRDNMKFYAEQLVQRGHNFAIVDEVDSILIDEARTPLIISGASEESTGLYRHMD
EIVRKLTRDTHFTVDEKARTAMLTDEGVAFCEKLVGIDNLYDPGNITTQHHLMQALKAHN
LFRRDVDYIVKEGQVVIVDEFTGRLMPGRRFSDGLHQALEAKEAVKIEAENQTLASITFQ
NYFRMYAKLAGMTGTADTEAVEFHQIYSLEVVSIPTNKPMQRKDFADAIYRTKREKYDAI
AQAIAELHKAGQPVLVGTISIETSELLSTMLKKTGVPHSVLNAKHHEKEAEIVALAGQRG
HVTIATNMAGRGTDIVLGEGVRELGGLHILGTERHESRRIDNQLRGRSGRQGDPGSSRFY
LSLEDDLMRLFGSERISGLMEKLGMEEGEPIEARMVSRAIENAQKRVEGHNFEIRKTLLD
YDNVMNQQREVIYTLRRDAMSAPDLGPTMEEFLDDVLEDVYAPAEGGEAPSADTVAAVWG
RLADVCNITRVMQPAPALPTRDEARAAVLSILHELREDTGESYRDIIRYFMLEELDRCWK
EHLRNMDHLRDGIGLRGYGQRDPKLEYKREGFAMFQEMLFRIKEGVFRSLTRLRVQRVEE
EAFRHKEQPAAVAYSGGEAEAGPAQPHREDPKVGRNDLCPCGSGRKYKKCCGA