Protein Info for DVU0818 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: conserved domain protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 582 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 31 to 53 (23 residues), see Phobius details amino acids 65 to 87 (23 residues), see Phobius details amino acids 100 to 123 (24 residues), see Phobius details amino acids 142 to 163 (22 residues), see Phobius details amino acids 168 to 186 (19 residues), see Phobius details amino acids 194 to 213 (20 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 96% identity to dvu:DVU0818)

Predicted SEED Role

"Glycerate kinase (EC 2.7.1.31)" in subsystem Allantoin Utilization or D-galactarate, D-glucarate and D-glycerate catabolism or Glycerolipid and Glycerophospholipid Metabolism in Bacteria or Glycine and Serine Utilization or Photorespiration (oxidative C2 cycle) or Serine-glyoxylate cycle (EC 2.7.1.31)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.31

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72DW1 at UniProt or InterPro

Protein Sequence (582 amino acids)

>DVU0818 conserved domain protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MLELVVFVSGALVMVLEMVGARVLAPHLGTSVIVWTSLIGVVLACLAAGAWLGGRLADRA
VSERALARILAAAGAGTLLTALLHGIVGEAISERVPDLRAGAVVAAIILFGGPATLFGMV
GPYVARLRLADMRTAGATVGRLSALSTAGSIVGTFLGGFVLVSYFGSTHILLGTGGGMVA
LSLMACRSRPAARLLLLCGVGALLWATASYAAYAEEATGIRVVETPYNHIRVYEGLMPDG
LRLRCLATDPGRMQSAMYPDRPDELALPYTRFFALGPLLVPDASKVLMLGGGAFSVPRWL
LAGGGGLDASRLSVDVVELDPGMTAEARRSFGLTDDPRLRVFHEDARVFCNRNRERYDLV
LVDVFGSHYTVPFHAGTVEAARTLRAVTRDDGVLLMNVIAAMDGVDGRLFRAIRGALAAH
FAEVHVFAVRDSEDRHGVQNLMLLALPVPRPDFAPYLADVGERIRHAGTPTAAARDEVPH
TGGNGMATVSGGVVPDAAMPDAAMPDAAMPDAAIPDAAMPDGVMLDSTSASSPHPVTHLP
VTDVEMVRLLASRVRALSPDDTPPLRDDFAPVERYALGLLRR