Protein Info for DVU0814 in Desulfovibrio vulgaris Hildenborough JW710

Name: bcp
Annotation: bacterioferritin comigratory protein, putative (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 161 PF08534: Redoxin" amino acids 11 to 140 (130 residues), 60.5 bits, see alignment E=1.7e-20 PF00578: AhpC-TSA" amino acids 11 to 138 (128 residues), 121.9 bits, see alignment E=1.6e-39

Best Hits

Swiss-Prot: 46% identical to BCP_XANCP: Peroxiredoxin Bcp (bcp) from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)

KEGG orthology group: K03564, peroxiredoxin Q/BCP [EC: 1.11.1.15] (inferred from 100% identity to dvu:DVU0814)

MetaCyc: 39% identical to thiol peroxidase (Escherichia coli K-12 substr. MG1655)
1.11.1.15-RXN [EC: 1.11.1.24]

Predicted SEED Role

"Thiol peroxidase, Bcp-type (EC 1.11.1.15)" in subsystem Thioredoxin-disulfide reductase (EC 1.11.1.15)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.11.1.15

Use Curated BLAST to search for 1.11.1.15 or 1.11.1.24

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72DW5 at UniProt or InterPro

Protein Sequence (161 amino acids)

>DVU0814 bacterioferritin comigratory protein, putative (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MQMRPIDLTDRPAPPFSLDDAQGTQRTLASWLGTWLVLYFYPRANTPGCTREGVEFTSVL
PDFTALGATVVGISPDTPKTLCNFAAKHSLGVTLLSDRDRSVAEHYGVLQMKRLYGKESL
GIVRTTLLVDPEGVVRHVWSPVKLEGHAEDVLSTLADLVQR