Protein Info for DVU0779 in Desulfovibrio vulgaris Hildenborough JW710

Name: atpF2
Annotation: ATP synthase F0, B subunit, putative (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 176 signal peptide" amino acids 1 to 14 (14 residues), see Phobius details transmembrane" amino acids 24 to 42 (19 residues), see Phobius details PF00430: ATP-synt_B" amino acids 24 to 153 (130 residues), 56.8 bits, see alignment E=2.7e-19 PF05405: Mt_ATP-synt_B" amino acids 28 to 145 (118 residues), 29.3 bits, see alignment E=6.5e-11

Best Hits

Swiss-Prot: 100% identical to ATPF_DESVH: ATP synthase subunit b (atpF) from Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303)

KEGG orthology group: K02109, F-type H+-transporting ATPase subunit b [EC: 3.6.3.14] (inferred from 100% identity to dvl:Dvul_2191)

Predicted SEED Role

No annotation

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.14

Use Curated BLAST to search for 3.6.3.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72E00 at UniProt or InterPro

Protein Sequence (176 amino acids)

>DVU0779 ATP synthase F0, B subunit, putative (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MTLFFASMAYASGDSGHGPDWGNFAFRVVNFVIFAGIIWKAAGKKIVGFFTGRRQGIEQE
LNDLETRKTEAKKQLAEVERRIANLESERQAILADYRAQGENIKAAIIDKAEKSASLITE
QAKRTADNEIKAAIDAMRAQMADEIIVAAEKLLAEKLTANEHEKLIDKYLTKVVLN