Protein Info for DVU0776 in Desulfovibrio vulgaris Hildenborough JW710

Name: atpG
Annotation: ATP synthase, F1 gamma subunit (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 291 TIGR01146: ATP synthase F1, gamma subunit" amino acids 1 to 289 (289 residues), 297 bits, see alignment E=9.8e-93 PF00231: ATP-synt" amino acids 3 to 289 (287 residues), 321.6 bits, see alignment E=3.1e-100

Best Hits

Swiss-Prot: 100% identical to ATPG_DESVH: ATP synthase gamma chain (atpG) from Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303)

KEGG orthology group: K02115, F-type H+-transporting ATPase subunit gamma [EC: 3.6.3.14] (inferred from 100% identity to dvu:DVU0776)

Predicted SEED Role

"ATP synthase gamma chain (EC 3.6.3.14)" in subsystem F0F1-type ATP synthase (EC 3.6.3.14)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.14

Use Curated BLAST to search for 3.6.3.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72E03 at UniProt or InterPro

Protein Sequence (291 amino acids)

>DVU0776 ATP synthase, F1 gamma subunit (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MPSLKDVKVKIAGVKKTKQITKAMNMVASAKLRGAQQRIERFRPYAEKFYGMLGDLASKA
DGSAHPLLEVRDEIKTCGIVLATSDRGLCGSFNANLISTALKLAKQKAAEGKTVKFYCVG
KKGRDTIRKADFEVVTAIADQMGSFDFQLANKLGLEVINHYLTGELDEVVLVYGEFVSTA
KQLPITLPILPIASEKKDEAEAAPSKEYIYEPAVEGLLAELLPRFIKVQIYRGLLDTSAS
EHAARMAAMDNATRSCDDMIGALTLLFNKTRQASITRDLMDIVGGAEALKG