Protein Info for DVU0771 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: molybdenum-pterin binding domain protein/site-specific recombinase, phage integrase family (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 356 PF00589: Phage_integrase" amino acids 61 to 199 (139 residues), 38 bits, see alignment E=1.5e-13 TIGR00638: molybdenum-pterin binding domain" amino acids 218 to 282 (65 residues), 59.4 bits, see alignment E=1.3e-20 PF03459: TOBE" amino acids 219 to 281 (63 residues), 52.6 bits, see alignment E=4.4e-18 amino acids 290 to 353 (64 residues), 33.9 bits, see alignment E=3e-12

Best Hits

KEGG orthology group: K02019, molybdate transport system regulatory protein (inferred from 100% identity to dvl:Dvul_2199)

Predicted SEED Role

"DNA-binding domain of ModE / Molybdate-binding domain of ModE" in subsystem Molybdenum cofactor biosynthesis or Transport of Molybdenum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72E08 at UniProt or InterPro

Protein Sequence (356 amino acids)

>DVU0771 molybdenum-pterin binding domain protein/site-specific recombinase, phage integrase family (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MEGSLETLFAGVASRANPAGMLTIPDEVRCLDTNDLEKLESAFRAWVAKGRGAGVTLARR
RILALFLLLRHTGARLGEASGLEGRSLVLEKGLVRLGTPPRDVLVAETVLAEIVGLVTTG
GGRESPVLPEYPFAVDPGHVRRKFYACAEAAGLGREMGSPSVLRRSRAVELLRGGVPLPA
VQRLLGHGNAELTAAYVAVPDDAMRRMVGDALDREQRRSSARNAFFGRVEDVRIGDVQAS
VRLQTPTGLEVLAIITNDSLEALGLARGAYALAEVKAPWVVLQRGEHPRSSAGNVYPGEV
VRVRKGAVSAEVIVRLDAGTEVCAVLAADTLATLELCDGAHVWVVINALSVILNAV