Protein Info for DVU0770 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: membrane protein, putative (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 316 transmembrane" amino acids 12 to 38 (27 residues), see Phobius details amino acids 78 to 99 (22 residues), see Phobius details amino acids 110 to 127 (18 residues), see Phobius details amino acids 195 to 223 (29 residues), see Phobius details amino acids 232 to 254 (23 residues), see Phobius details amino acids 266 to 283 (18 residues), see Phobius details amino acids 294 to 314 (21 residues), see Phobius details PF01925: TauE" amino acids 17 to 309 (293 residues), 147.6 bits, see alignment E=2.6e-47

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvl:Dvul_2200)

Predicted SEED Role

"membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72E09 at UniProt or InterPro

Protein Sequence (316 amino acids)

>DVU0770 membrane protein, putative (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MYFPTAGIEANPLLPVCVAFVVSFFASMGGISGAFLLLPFQMSVLGYTAPSVSATNQFYN
IVAIPSGVARYIREGRMVWPLVWVVVAGTLPGVLVGAFLRVRWLPDARDFKLFVGLVLLY
IGFRMVRDLLRPARNGKARADERFAELAARHRAQAEALGVAPESLPTTRVVRRTWRTVEY
EFYGEPHTFPVQGTFILSLVVGMIGGTYGIGGGAIIAPFLISVFGLPVHTVAGAALMGTF
VTSIAGVLFYMGIAPFYPALSVSPDWMLGLMLGLGGMCGMYLGARCQKHVPARLIKWMLA
VVLATTATRYVAGYFF