Protein Info for DVU0769 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: pyridoxal kinase, putative (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF08543: Phos_pyr_kin
  • amino acids 30 to 260 (231 residues), 87.2 bits, E=1.2e-28
• PF00294: PfkB
  • amino acids 126 to 249 (124 residues), 26.9 bits, E=3.1e-10

Best Hits

KEGG orthology group: K00868, pyridoxine kinase [EC: 2.7.1.35] (inferred from 100% identity to dvl:Dvul_2201)

Predicted SEED Role

"Pyridoxal kinase (EC 2.7.1.35)" in subsystem Pyridoxin (Vitamin B6) Biosynthesis (EC 2.7.1.35)

MetaCyc Pathways

• pyridoxal 5'-phosphate salvage I (5/6 steps found)
• superpathway of pyridoxal 5'-phosphate biosynthesis and salvage (9/12 steps found)
• pyridoxal 5'-phosphate salvage II (plants) (5/9 steps found)
• 4-amino-2-methyl-5-diphosphomethylpyrimidine biosynthesis II (4/8 steps found)

KEGG Metabolic Maps

• Vitamin B6 metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.35

Sequence Analysis Tools

See Q72E10 at UniProt or InterPro

Protein Sequence (292 amino acids)

>DVU0769 pyridoxal kinase, putative (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MRSPVPRVAAIHDLSGFGRTSLTVAIPVLSAMGIQVCPMPTAMLSTHTSGFKGFSFIDLT
AEMRRFFDHWKSLNIRFDAIYSGFLGSPDQVAIVAQCIDMFRTPDGFAVVDPVLGDNGEL
EPTMDMEMVHRMRWLVSKADIITPNFTEAALLLDEPYREHIDQPTLKDWLRRLTAMGPHV
AVVTSVPVEGSRTTTSVVAYNRPHDRFWKVDCQYIPAHYPGTGDTFASVLTGSILQGDSL
PIAIERAVQFVTMGIRATFGHNSPSREGILLERVLDTLRAPVTMSSYELLEE