Protein Info for DVU0768 in Desulfovibrio vulgaris Hildenborough JW710

Name: murI
Annotation: glutamate racemase (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 282 TIGR00067: glutamate racemase" amino acids 10 to 257 (248 residues), 220.1 bits, see alignment E=1.6e-69 PF01177: Asp_Glu_race" amino acids 24 to 224 (201 residues), 67.5 bits, see alignment E=7.4e-23

Best Hits

Swiss-Prot: 42% identical to MURI_NEIMA: Glutamate racemase (murI) from Neisseria meningitidis serogroup A / serotype 4A (strain Z2491)

KEGG orthology group: K01776, glutamate racemase [EC: 5.1.1.3] (inferred from 100% identity to dvl:Dvul_2202)

Predicted SEED Role

"Glutamate racemase (EC 5.1.1.3)" in subsystem Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis or Peptidoglycan Biosynthesis (EC 5.1.1.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.1.1.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72E11 at UniProt or InterPro

Protein Sequence (282 amino acids)

>DVU0768 glutamate racemase (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MTVEQARLPIGLFDSGVGGLTVLKALRQRMPCEDMLYLGDTARLPYGTKSSETIARYALQ
ATSKLVERRIKLLVVACNTATSVALDTLREAYPGIPVIGVVEPGAQASCRASLQGRIAVI
ATESTIRGRAYHKAIHRLRPQAHIVGQACPLFVPLAEEGWVDGPIAESIAARYLDPIFKP
ASGSDRVETPDCLVLGCTHFPLLARAIRNVIGPDVVIVDSAATTAFAVHQELDARGLIHP
QHGDDCGTTRFLTTDDVPRFARTGGLFLGTPIAPDEVELVDL