Protein Info for DVU0743 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: sensory box histidine kinase (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 665 PF00989: PAS" amino acids 46 to 146 (101 residues), 24.5 bits, see alignment E=8.1e-09 amino acids 299 to 407 (109 residues), 46.7 bits, see alignment E=1e-15 PF13188: PAS_8" amino acids 47 to 90 (44 residues), 16.1 bits, see alignment 2.9e-06 amino acids 298 to 350 (53 residues), 21.1 bits, see alignment 7.8e-08 PF08448: PAS_4" amino acids 50 to 147 (98 residues), 37.5 bits, see alignment E=8.9e-13 amino acids 163 to 267 (105 residues), 28.6 bits, see alignment E=5.2e-10 amino acids 303 to 417 (115 residues), 35.6 bits, see alignment E=3.3e-12 TIGR00229: PAS domain S-box protein" amino acids 296 to 420 (125 residues), 61.9 bits, see alignment E=3.2e-21 PF13426: PAS_9" amino acids 307 to 414 (108 residues), 36.1 bits, see alignment E=2.3e-12 PF08447: PAS_3" amino acids 320 to 408 (89 residues), 32 bits, see alignment E=4.4e-11 PF00512: HisKA" amino acids 432 to 493 (62 residues), 37.2 bits, see alignment E=8.7e-13 PF02518: HATPase_c" amino acids 542 to 658 (117 residues), 69.5 bits, see alignment E=1.1e-22

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvu:DVU0743)

Predicted SEED Role

"Signal transduction histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72E36 at UniProt or InterPro

Protein Sequence (665 amino acids)

>DVU0743 sensory box histidine kinase (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MMAGRSSHDTGEELERLREEVRLLREALRLASSTLPTGPDVAGCMSDIVHALPVLAFCCD
TDGRVVTANSRFAAMCQCSPVSRTLRDVLPTATVDELLCLVERAWQAQDVRSGVVPMPPG
LFQCVVQPRLDAAGRLSRVLCVGHDVSGLLRGNHELVHALVGASPVTTLLLDRECTVLLG
NASAAALMLWPPEGQGDGDCFRFLPEDIATRRREEVLRCFETGCAVEFEDTQDGRTYHHF
VRPIPARDHGATVVGEVAVYSLDVTLPRRAEADLRAAARLHAALAEASSRQFDRQSALLD
RVFDEVPAGICLMDITGRVLHLNRAMADVVGASETELVGTDCFAMLHPADRAAARALFMH
DLENAGSPEGFHELKEYRFLRKDGTARECQVASAMLRDGDGPILGMAVVTDVTEMRRIKA
EAARMGQLATIGELAAGVAHEINSPANAIINCADLLMEDAFDSAMVRDMARRIRSEGQRV
AAITHNLLAFARERKPPPPPALVDVKVVLRDTLELTAAQMRAEGILLEVSCSSGALHVLG
RTRELQQVFLNIVSNARHALNAIPGSAARCLSINAEPRAAGSCVSGPVVSVSFRDTGGGI
DPSIRDRVMEPFFTTKGEGRGTGLGLSISNAIIEDHGGVLCIESDGETGTCVTVELPQMV
EDGDA