Protein Info for DVU0736 in Desulfovibrio vulgaris Hildenborough JW710

Name: purN
Annotation: phosphoribosylglycinamide formyltransferase (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 225 PF00551: Formyl_trans_N" amino acids 3 to 182 (180 residues), 190 bits, see alignment E=1.7e-60 TIGR00639: phosphoribosylglycinamide formyltransferase" amino acids 3 to 192 (190 residues), 243.9 bits, see alignment E=4.7e-77

Best Hits

Swiss-Prot: 48% identical to PUR3_ECOLI: Phosphoribosylglycinamide formyltransferase (purN) from Escherichia coli (strain K12)

KEGG orthology group: K11175, phosphoribosylglycinamide formyltransferase 1 [EC: 2.1.2.2] (inferred from 100% identity to dvu:DVU0736)

MetaCyc: 48% identical to phosphoribosylglycinamide formyltransferase 1 (Escherichia coli K-12 substr. MG1655)
Phosphoribosylglycinamide formyltransferase. [EC: 2.1.2.2]

Predicted SEED Role

"Phosphoribosylglycinamide formyltransferase (EC 2.1.2.2)" in subsystem De Novo Purine Biosynthesis (EC 2.1.2.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.2.2

Use Curated BLAST to search for 2.1.2.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72E43 at UniProt or InterPro

Protein Sequence (225 amino acids)

>DVU0736 phosphoribosylglycinamide formyltransferase (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MLRIAVLASGNGSNLQAILDRIASGALDAEVGVVISNKPQARALERARSAGVPSLALDPA
AYADRESYDAALVEAIRAAGAQCVVLAGYMRLLTPVFLAAFPGAVINIHPSLLPSFPGLR
GAGDALDYGVRLAGCTVHFVNEEMDGGAVIVQAAVPVTPGEPLDDLKARIHAMEHRIYPQ
ALQWLAQGRLRVEGRCVHVAPPDSGVVPAAAGGAWLVSPPLEPGF