Protein Info for DVU0726 in Desulfovibrio vulgaris Hildenborough JW710

Name: tgt
Annotation: queuine tRNA-ribosyltransferase (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 375 TIGR00430: tRNA-guanine transglycosylase" amino acids 7 to 369 (363 residues), 533.1 bits, see alignment E=3.4e-164 TIGR00449: tRNA-guanine family transglycosylase" amino acids 7 to 372 (366 residues), 507.3 bits, see alignment E=2.2e-156 PF01702: TGT" amino acids 14 to 370 (357 residues), 536.2 bits, see alignment E=2e-165

Best Hits

Swiss-Prot: 100% identical to TGT_DESVH: Queuine tRNA-ribosyltransferase (tgt) from Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303)

KEGG orthology group: K00773, queuine tRNA-ribosyltransferase [EC: 2.4.2.29] (inferred from 100% identity to dvl:Dvul_2243)

MetaCyc: 59% identical to preQ1 tRNA-ribosyltransferase (Clostridioides difficile)
tRNA-guanine transglycosylase. [EC: 2.4.2.29]

Predicted SEED Role

"tRNA-guanine transglycosylase (EC 2.4.2.29)" in subsystem Queuosine-Archaeosine Biosynthesis (EC 2.4.2.29)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.29

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72E53 at UniProt or InterPro

Protein Sequence (375 amino acids)

>DVU0726 queuine tRNA-ribosyltransferase (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MTTPGTFEIHATDGAARTGCLHTAHGIVRTPIFMPVGTVGSVKAIAPDDLEAIGAEIILG
NTYHLYLRPGDELVARRGGLHEFNAWRKPILTDSGGFQVFSLSGLRRIAEEGVEFRSHLD
GSKHLFTPEKVVSIQRNLNSDIMMVLDECVPYGADRTYTEKSVGLTTRWAKRCRDAYPKG
AAGNLLFGITQGGFFKDLRTRSIGALTDIDFDGFALGGLSVGEPKAEMMDLLYHSAPLLP
ADKPRYLMGVGTPLDIINGIAAGVDMFDCVLPTRNARNGTLYTSLGKLNIKRREFAEDDG
PLDPACSCYTCRTFSRAYLRHLYTAKELLAFRLNSIHNLTYFLDLVRGARAAIAAGRFAE
YKRSFEAIYPEEVVA