Protein Info for DVU0721 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: sensory box histidine kinase (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 921 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 335 to 357 (23 residues), see Phobius details TIGR00229: PAS domain S-box protein" amino acids 370 to 495 (126 residues), 41.2 bits, see alignment E=8.3e-15 amino acids 498 to 627 (130 residues), 44.7 bits, see alignment E=6.7e-16 PF13188: PAS_8" amino acids 373 to 426 (54 residues), 34.3 bits, see alignment 4.7e-12 PF00989: PAS" amino acids 500 to 617 (118 residues), 28.7 bits, see alignment E=3.4e-10 PF08447: PAS_3" amino acids 523 to 614 (92 residues), 59.7 bits, see alignment E=8.4e-20 PF02518: HATPase_c" amino acids 804 to 910 (107 residues), 77.3 bits, see alignment E=3.8e-25

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvl:Dvul_2248)

Predicted SEED Role

"sensory box histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72E58 at UniProt or InterPro

Protein Sequence (921 amino acids)

>DVU0721 sensory box histidine kinase (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
VFLLRVVLFLLIYASLSGPVLAAGEKRVLVLESGWHDWHWAGEFARGVHWVFDATPGVDV
VQNRIDLPHATTPSYEAMLADLLVARYRDDMPDVVIAGDDRVSKYLDTYGADIFPHTPKV
YCYVLPGGGRVQGVLAGGVVSTPDVAGTLLLMRQMQPRLSHVLVVNDRSSGTEVIADEVR
RAAATALPGVTLAFIDQWTVAELAARLRSLSPGSAVLFTSLEQDAVGVRIGSRDLQMLTA
VSSVPVYSLWDWHVRLGAVGGVVSDGMGVGGRIARIAQRWLNGLEPHLGVESTSINITLV
DALTMARFGLATGGLPVGASVVNKPPDMREAAPGLFYGGLVVLLVLSLVVAGLGLNTLQR
RKVMRRLSAAESRYRSLFENALEGIFRFSPTQGILAANPAFASMLGYGGVEGLLADAGGS
MHSLFESDEEYATLLSRLETDEVLRGVECRLRRRDGTSIVAALSLRADRGADGDITLVEG
RAVDVTAEKQARADLEVQRERLRLALDASRDGIWDWDTVNDTVHFSSRYFTMLGYAPDAF
ANELAVWLDLLHPEDRDEAVERARRFVEGVADGDAYETTFRLRAADGAYRWVLSRSMAAA
RDMNRRAIRVVGVHTDVTELREAQEQLASFNRELEERVKQRTRELREANQALEFSLDAVR
RMQDELVQSEKMASLGGLVAGVAHEINTPVGIGVTAGSWLAEKTEELSRQLAANTMRKSD
LERYIETARESSATILSNLKRAADLVQSFKQVAVDQTAAEAREFNLRQFLDEALMSLRPR
YKRTSHTVTVDVPEDITLYSYPGDLMQVVTNFMTNSLLHGFEDMENGHMRFVASYEGDKV
VLEYSDDGKGMDADHVERVFEPFFTTKRGHGGTGLGMHIVYNIVTQRLKGTIVCRSAPGE
GAAFRLVFPRDVRKGGGSGER