Protein Info for DVU0720 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: HAMP domain protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 429 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details transmembrane" amino acids 273 to 296 (24 residues), see Phobius details PF05228: CHASE4" amino acids 54 to 193 (140 residues), 105.7 bits, see alignment E=2.3e-34 PF13188: PAS_8" amino acids 358 to 408 (51 residues), 28.7 bits, see alignment 9.4e-11

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvu:DVU0720)

Predicted SEED Role

"HAMP domain protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72E59 at UniProt or InterPro

Protein Sequence (429 amino acids)

>DVU0720 HAMP domain protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MQTLARKSALLFIAAMCSLTALVLVTARYAFVDSFTRIETREALSATRQAQALLLASRDA
MHRQCADWAAWDDSYEFVTRRDTDFVERNVTLQAFSDNDVDLMAFYDAQGQPILVRMRGA
DNSYFRDPPKDLTDALAPQGELGRKLANDAPFAGLLSLYEGPLFVSARPITRSTDPTRRG
GWLVWGRYALGALPPFFSDLLPHAAQLFTPGSYDTPPQVAALFTSAAKRDPQVRPLDDST
MEGLAVLTDIKGDPGLAMRILMPREASEQGNKALMLFSLVILVGTALVAATAQVLFQKHV
GRRAASLAADIERVRISGFRSPLPADGDDEIAAIGHAINRLIRDREQAAHTLQENEAFFR
LLYEQAPDAMLLLLDESIASANDAAARLLGVADRKDLLSHPLIEFFPPAQEGGGVAPAKP
DTLRLLTVG