Protein Info for DVU0710 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: competence protein comM, putative (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 554 signal peptide" amino acids 1 to 16 (16 residues), see Phobius details PF13541: ChlI" amino acids 21 to 135 (115 residues), 119.4 bits, see alignment E=2.5e-38 TIGR00368: Mg chelatase-like protein" amino acids 171 to 547 (377 residues), 452.9 bits, see alignment E=6.5e-140 PF01078: Mg_chelatase" amino acids 238 to 443 (206 residues), 326.3 bits, see alignment E=1.9e-101 PF07728: AAA_5" amino acids 261 to 398 (138 residues), 27.8 bits, see alignment E=6.8e-10 PF00493: MCM" amino acids 336 to 408 (73 residues), 27.1 bits, see alignment E=6.6e-10 PF13335: Mg_chelatase_C" amino acids 452 to 547 (96 residues), 103.7 bits, see alignment E=2e-33

Best Hits

KEGG orthology group: K07391, magnesium chelatase family protein (inferred from 100% identity to dvu:DVU0710)

Predicted SEED Role

"MG(2+) CHELATASE FAMILY PROTEIN / ComM-related protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72E69 at UniProt or InterPro

Protein Sequence (554 amino acids)

>DVU0710 competence protein comM, putative (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MIARVACAALQGVDATRVDLEVDFARQGMPAFTLVGLAEGAVREARERVMAALRAVGLRL
PPARITVNLAPADRRKGGSGYDLPLAVALLEAAGIIPEGSTRGWFFAGELSLAGELKPVP
GILPVAILARDEAARAAAGQPPKAHPEGVSSCARQTDAQPAGVRPADTRSATAGHDGTIR
GIIVPKVNAAEAAVVDGIAAYGASTLGEVVAFLAGEGDLVRAVPPGMAQGAGGVHLYDFA
EVKGQEHAKRAIEIAAAGAHNLLFIGPPGSGKTMLAQRIPSVLPPLTPADALEVTKVYSV
AGLLDAGQGLVSQRPFRAPHHTVSEVGLAGGGAYPRPGEVSLAHRGVLFLDELPEFRKTA
LEVLRQPLEDGVVTISRAMQTLTYPADCMLVAAMNPCPCGYATDATHACTCSTMQVQRYR
ARLSGPLLDRIDLHVEVPAVPWEDLRSVKGGTSSAEMRERIMAARAVQTARFAGTHCRTN
ADLGGALLEEHCRLGTPEHTFLGKAVHSLALSARAYTRILRIARTIADLDGSEPLQVRHL
AEAINCRVLDRERM