Protein Info for DVU0707 in Desulfovibrio vulgaris Hildenborough JW710

Name: dctP
Annotation: TRAP dicarboxylate family transporter (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 338 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF03480: DctP" amino acids 31 to 319 (289 residues), 244 bits, see alignment E=1e-76 TIGR00787: TRAP transporter solute receptor, DctP family" amino acids 36 to 269 (234 residues), 195.4 bits, see alignment E=5.9e-62

Best Hits

KEGG orthology group: None (inferred from 99% identity to dvl:Dvul_2257)

Predicted SEED Role

"TRAP-type C4-dicarboxylate transport system, periplasmic component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72E72 at UniProt or InterPro

Protein Sequence (338 amino acids)

>DVU0707 TRAP dicarboxylate family transporter (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MKRFVVLLALCLVFTSLTVNAAEYKPEYRLSTVLGPAFPWGRAAERWANLVRENTEGRIN
IKVYPGTSLVGGDQTKEFTAIRQGVIDMAVGSSINWSPQVKQLNLFSLPFLMPDEKAFDA
LTTGPVAADIFAILDKQGVVPLAIGENGFRELSNSKVNVTSPADLKGLKIRVVGSPIFID
GFTALGANPTQMSWADAQPALATKAVDGQENPLSVFNAAKLHTVEQKYLTLWGYMADPLF
YVVSKKVWEEWSEADRAIVAEAAKQTAAENLIDARKGITPEDDSLLKEIEKNGVTVTRLT
DEQRKPFQKATRPVFDKWAEVVGKDLVKKAEDAIAASR