Protein Info for DVU0686 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: iron-sulfur cluster-binding protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 162 signal peptide" amino acids 1 to 16 (16 residues), see Phobius details PF12800: Fer4_4" amino acids 2 to 14 (13 residues), 13.6 bits, see alignment (E = 4.8e-05) amino acids 76 to 90 (15 residues), 19.1 bits, see alignment (E = 8.4e-07) amino acids 102 to 116 (15 residues), 19.8 bits, see alignment (E = 4.8e-07) PF12797: Fer4_2" amino acids 70 to 90 (21 residues), 25.6 bits, see alignment (E = 5.5e-09) PF12837: Fer4_6" amino acids 71 to 92 (22 residues), 29.3 bits, see alignment (E = 3.7e-10) PF13237: Fer4_10" amino acids 71 to 116 (46 residues), 35.6 bits, see alignment E=4.8e-12 PF00037: Fer4" amino acids 71 to 93 (23 residues), 36.4 bits, see alignment 2.1e-12 PF14697: Fer4_21" amino acids 72 to 122 (51 residues), 35.7 bits, see alignment E=5e-12 PF12798: Fer4_3" amino acids 78 to 92 (15 residues), 19.4 bits, see alignment (E = 9.5e-07)

Best Hits

KEGG orthology group: None (inferred from 99% identity to dvl:Dvul_2277)

Predicted SEED Role

"Thiosulfate reductase electron transport protein phsB" in subsystem Anaerobic respiratory reductases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72E92 at UniProt or InterPro

Protein Sequence (162 amino acids)

>DVU0686 iron-sulfur cluster-binding protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MERCIGCHACSLACARLVHKRLSWVTAGIRITSAGGLSTGFEARLCLACDPAPCAQACPT
GAYAQRKGGGVKVDRSLCIRCGRCAEACPVDAVHMDGETGLPYVCIHCGRCVAFCPHECI
ELVDQPVADAASDEAGRETGDDKALPRKAGLVNDASEVGHAD