Protein Info for DVU0685 in Desulfovibrio vulgaris Hildenborough JW710

Name: rfbB
Annotation: phosphomannomutase (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 453 PF02878: PGM_PMM_I" amino acids 8 to 138 (131 residues), 127.4 bits, see alignment E=6.5e-41 PF02879: PGM_PMM_II" amino acids 153 to 250 (98 residues), 90.2 bits, see alignment E=2.4e-29 PF02880: PGM_PMM_III" amino acids 254 to 358 (105 residues), 72.7 bits, see alignment E=5.5e-24 PF00408: PGM_PMM_IV" amino acids 372 to 442 (71 residues), 51.9 bits, see alignment E=1.2e-17

Best Hits

KEGG orthology group: K01840, phosphomannomutase [EC: 5.4.2.8] (inferred from 100% identity to dvl:Dvul_2278)

Predicted SEED Role

"Phosphomannomutase (EC 5.4.2.8)" in subsystem Alginate metabolism or Mannose Metabolism (EC 5.4.2.8)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.4.2.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72E93 at UniProt or InterPro

Protein Sequence (453 amino acids)

>DVU0685 phosphomannomutase (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MKALSAHVFRAYDIRGIVDTDFDPEWVERLGRACGTYFVSHGHGAAVVGFDCRHSSPAYH
DALVRGLLSTGVDVTSVGMVPTPVLYFAVKHLGRKAGVMITASHNPSEYNGFKVVAGEST
IHGEEIRRIWEVFERGEFASGHGIGCSHDIVPSYIEAITSDVHPARKLKVVVDGGNGAGG
ELCVEVLRRLGVEVVAQFCEPDGDFPNHHPDPVVEANMTALMERVQVERADLGIGLDGDA
DRLGAVDGMGRLLNGDELLSLYAREMLARRPGETVIADVKCSHRLFDDIEAHGGKPMMWI
TGHSVVKARMLEVGAPLAGELSGHMFFGDRWFGFDDAIYGAARLVELLAASDVPLTDLPG
WPPSHATRELHLPCPEHAKFEVVRRAQAYFRERCTINDIDGARVIFPDGWGLVRASNTQP
VLVLRFEAQTPERLAEIRAFVEEPLRRWVAELS