Protein Info for DVU0681 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: sensor histidine kinase/response regulator (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 667 PF00072: Response_reg" amino acids 6 to 115 (110 residues), 78.3 bits, see alignment E=7.7e-26 amino acids 411 to 524 (114 residues), 83.7 bits, see alignment E=1.5e-27 PF00512: HisKA" amino acids 141 to 205 (65 residues), 65.8 bits, see alignment E=4.4e-22 PF02518: HATPase_c" amino acids 253 to 380 (128 residues), 98.6 bits, see alignment E=4.7e-32

Best Hits

KEGG orthology group: K00936, [EC: 2.7.3.-] (inferred from 100% identity to dvu:DVU0681)

Predicted SEED Role

"Sensory box histidine kinase/response regulator"

Isozymes

Compare fitness of predicted isozymes for: 2.7.3.-

Use Curated BLAST to search for 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72E97 at UniProt or InterPro

Protein Sequence (667 amino acids)

>DVU0681 sensor histidine kinase/response regulator (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MPNLRIIVVDDEQIVALDLRRTLEGLGYIVPAVETDADGAIDAAKRLRPDLVLMDIRLRR
GDGVDAAHVITNQFDIPVVFLTAFSDEATLSRAMKAGPFGFLVKPFAERELYSTIEVALL
KHRAVREIDEARQAAEHASLAKTSFLAGMSHEIRNTLNGIVGMTELVLDTPLSGEQRESL
NTVLASSETLLTLLHDVLDFSRLEARQLRLVERPFSLDRLLKQVVQASRSEAERKNISLD
FRVTPDVPDRLTGDATRLTQVLANLVGNAVKFTHKGSVIIEVSAIPQDQTLLESLFPDGP
PSSLTLLFSIRDTGIGIADEHLRTIFEAFSQGAEETVQRYGGTGLGLAICRNLVEIMGGS
IWARSSEGQGSSFHFTCRLRPETPAINTPSEHAQAPTSSATPASGARPLRVLVVDDDATG
RTITCKMLRKRGHVCACAHDGATALQRLTADRFDLVLLDVKMHPMGGLELLRRIRNAQYP
GVDRNIPVVAVTAHALKGDRERFLASGMTDYIAKPINARAFNAMLDRFALSASSARDIPV
IPDRSALLAPSEVVRRHGGDHNLVEPVWKAFCDEAPRHFALLAGALEEGDAQQAARFNKR
LRLASEHAGAVALAMLTERVGLCLVEDDTAGARQLVPRLESLLSRTIGLILSGMGTTEVP
PIEHTTD