Protein Info for DVU0680 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: sensory box histidine kinase (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 690 PF13188: PAS_8" amino acids 302 to 354 (53 residues), 29.7 bits, see alignment 8.9e-11 PF00512: HisKA" amino acids 434 to 499 (66 residues), 39.1 bits, see alignment E=1.3e-13 PF02518: HATPase_c" amino acids 548 to 656 (109 residues), 66.5 bits, see alignment E=5.7e-22

Best Hits

KEGG orthology group: K00936, [EC: 2.7.3.-] (inferred from 100% identity to dvu:DVU0680)

Predicted SEED Role

"sensory box histidine kinase"

Isozymes

Compare fitness of predicted isozymes for: 2.7.3.-

Use Curated BLAST to search for 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72E98 at UniProt or InterPro

Protein Sequence (690 amino acids)

>DVU0680 sensory box histidine kinase (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MPCRRRHRRSKATRSTTGIIALAHHRPHSVRHGHDGSAPHRTHHRLTMPTPPSAISPPFL
EGDTPFSSAVARLVEQLSDAPDCSGSPLGTTAAVLQPLTGWPPAEFLTRLLADLSSENNL
PTIERAILRQASGDFSPFALTLRGRSGPVHIQIAARPVGSGATIAAMPLPLAESIPTGDL
RSERSRLLNLLDRLPGYVMLIGSDHRIRYENRASRQLFGPGVGKACHEVLRGSPTPCAHC
PPCEVFETRTLCVSDWTRKNGSAFRVYAYPFEDIDGSSLVLKLGLDITTGVKALEALSRS
EERSRSITDNLAQGIAVIDPALRIEAANPRMLQWFGLDPVGMPLCRLLHDFCGDGNSRCS
GCPAIDVFRDGATHQRSFVLHLPGQPEERNFRLQACPISTQGQSVEAAVIMLDDETDRLR
VERQLAQARRLEALGTLATGVAHEINQPLSALRLYAGGLEMLVEKRPVVDRDMLLERLSR
ILREADRIRDIIEHMRALVTHGDIQCRPTSIAHACAEAFGLIGAQLRNHGIDASLDIAPD
LPDVLAVPVQLEQTLINLIVNAMHALDASRQPARDITVSARRHGNRVALSVEDNGPGLGL
MEDRVFDPFFTTKDAHSGMGLGLALVHGFVESWGGTITAASRRPPRTGAVFTIMLNASEA
APPCPAASRPSPSGLGPAPTPDNGDPSCAS