Protein Info for DVU0674 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: ABC transporter, permease protein, His/Glu/Gln/Arg/opine family (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 271 transmembrane" amino acids 14 to 36 (23 residues), see Phobius details amino acids 77 to 100 (24 residues), see Phobius details amino acids 121 to 142 (22 residues), see Phobius details amino acids 241 to 263 (23 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 67 to 162 (96 residues), 73.1 bits, see alignment E=1.1e-24 PF00528: BPD_transp_1" amino acids 94 to 267 (174 residues), 75 bits, see alignment E=3.3e-25

Best Hits

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 100% identity to dvu:DVU0674)

Predicted SEED Role

"Amino acid ABC transporter, permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72EA4 at UniProt or InterPro

Protein Sequence (271 amino acids)

>DVU0674 ABC transporter, permease protein, His/Glu/Gln/Arg/opine family (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MSAFAGQFRNGRAVVDVLAYVALMGGFLTVVVHGASQSGYVWQWYRAWRFLFVLPGDAGA
EGGASAGLLLQGLGVTLQVAAGSLVLALLLAAVAVALRLSCLRTGRLVARLYVESVRNTP
LLVQLFVTYFAIAPVFGLGRMASAVMALGVFEGAYMAEILRAGIAAVPQGQWEASRSLGM
DEPGTYVQVILPQALRRALPPLTGQAVSLVKDSSLASAIAIHELTMQAQTIIAETFLTFE
VWLLTAAIYLCVTLSLSAVARLLERRMHFDV