Protein Info for DVU0668 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: methyl-accepting chemotaxis protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 528 transmembrane" amino acids 6 to 29 (24 residues), see Phobius details amino acids 41 to 68 (28 residues), see Phobius details PF00989: PAS" amino acids 122 to 228 (107 residues), 34 bits, see alignment E=5.3e-12 PF08448: PAS_4" amino acids 128 to 233 (106 residues), 28.8 bits, see alignment E=2.4e-10 PF13426: PAS_9" amino acids 130 to 231 (102 residues), 34.1 bits, see alignment E=5.4e-12 PF00015: MCPsignal" amino acids 312 to 492 (181 residues), 155 bits, see alignment E=3.7e-49

Best Hits

KEGG orthology group: K03406, methyl-accepting chemotaxis protein (inferred from 100% identity to dvl:Dvul_2292)

Predicted SEED Role

"Methyl-accepting chemotaxis protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72EB0 at UniProt or InterPro

Protein Sequence (528 amino acids)

>DVU0668 methyl-accepting chemotaxis protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MQGFRALYIPASILTVLVLVAIGGFWCIAAKAGTGPLEAGAVWRVAAATLALVVACVAAL
CIWFGVAIRRPIDDVMTRLDRMLDGDTKLCFACDKVDAFGEMRLALDTLVGRLRQNLGFA
QGVLKGIDTPFVVVDAHEKLSYTNSNLLDILQHDGRPEDYYGQNVAHFFYGDASRRTVLR
DSIEQGTIARREVDLVGRKGGKRRLHINASPLYDLDGTLMGALCIYQDLTELRAREAELS
AQNARIAEAAATSEAISDEVARTAAALAEQVRGASGVAVQQSQRAREATIAMEQMNDAVL
SVARSASEAASEAEAARRRAEGGADVVRNAMAAIDEVDRLAAGLKQQLGDLGGRADGIGR
VIDVISDIADQTNLLALNAAIEAARAGDAGRGFAVVADEVRKLAEKTMQATQEVGNAIRA
IQEGTRSAVQGMETAVGAVERSRELSAQSGEALSGIVELVVQSSDQVQSIAAAAEQQSST
SESINRSVEAVRESADGLTGEMEAAGRAVRSLAEMTGRLHDLVHGMAV