Protein Info for DVU0652 in Desulfovibrio vulgaris Hildenborough JW710

Name: cheV-2
Annotation: chemotaxis protein CheV (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 316 PF01584: CheW" amino acids 30 to 156 (127 residues), 94.9 bits, see alignment E=3.5e-31 PF00072: Response_reg" amino acids 183 to 306 (124 residues), 53.6 bits, see alignment E=2.4e-18

Best Hits

KEGG orthology group: K03415, two-component system, chemotaxis family, response regulator CheV (inferred from 100% identity to dvu:DVU0652)

Predicted SEED Role

"Chemotaxis protein cheV (EC 2.7.3.-)" (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.3.-

Use Curated BLAST to search for 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72EC6 at UniProt or InterPro

Protein Sequence (316 amino acids)

>DVU0652 chemotaxis protein CheV (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MSQSKILLESGTNELEIVEFYIDEPGYRGHYGVNVAKVLEIIRKQTVTALPEMPHPAVLG
AFAHRGGRIIPLVDLAAYLGKPLSDDAAQRKIIITEFNQVVTGFLVSGVTRIHRISWIDV
EAPGRFLQGMSSSSITGVVRLEGRVVFLLDMESIVAEMHPDLSIRMGRTRATAQEAPMRR
YTVLHADDSGSVRKLVRNLLEASGRFEVLQADDGQGAWEMLETLRAEAEGRGQRIADVVQ
AVISDIEMPRLDGLTLCRRIKEDVALRVLPVALFSSLVTDKLEHKGRSVGADAQFAKPDL
QQLSERLLELLGETPA