Protein Info for DVU0651 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: membrane protein, putative (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 362 transmembrane" amino acids 26 to 44 (19 residues), see Phobius details amino acids 64 to 87 (24 residues), see Phobius details amino acids 107 to 128 (22 residues), see Phobius details amino acids 140 to 163 (24 residues), see Phobius details amino acids 171 to 191 (21 residues), see Phobius details amino acids 227 to 245 (19 residues), see Phobius details amino acids 270 to 295 (26 residues), see Phobius details amino acids 303 to 321 (19 residues), see Phobius details amino acids 340 to 361 (22 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvl:Dvul_2309)

Predicted SEED Role

"Predicted cobalt transporter in sulfate-reducing delta-proteobacteria" in subsystem Coenzyme B12 biosynthesis or Transport of Nickel and Cobalt

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72EC7 at UniProt or InterPro

Protein Sequence (362 amino acids)

>DVU0651 membrane protein, putative (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MSHSPHPTTAQPPRATTRRRNAGNRAALAFCLCVGGGALTFLLLRDPALLAWSRAWPALV
RPLGVMLLSLAAGLAAGLAIEGGGWAPMLARLASPVMRWGRLPEACGAAFTTAFLSAAAA
NSLLMEAYREGRITLREMRLGYLMGTGLPVFLLHLPTTFFIVTPLARGAGVTYLAINGLA
ALLRTVGVLVATRLTTMPHTAGEAPRTHHTPRTRTLRPFAERFRMRLTRLVLFTAPTYLL
MYALHQGGVFDVLRNATAHWLTDGFLPVEAAGVLVFSVASEFSSGVAAAGALLAAGSLTT
RETVLALIIGGIIATPLRAIRHQFPAHAGIFTPALGLSLLVQSQLLRIASVVVVTAAWLA
FA