Protein Info for DVU0649 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: iron compound ABC transporter, permease protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 351 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 66 to 87 (22 residues), see Phobius details amino acids 98 to 124 (27 residues), see Phobius details amino acids 127 to 153 (27 residues), see Phobius details amino acids 165 to 186 (22 residues), see Phobius details amino acids 206 to 226 (21 residues), see Phobius details amino acids 250 to 280 (31 residues), see Phobius details amino acids 286 to 310 (25 residues), see Phobius details amino acids 321 to 343 (23 residues), see Phobius details PF01032: FecCD" amino acids 18 to 344 (327 residues), 284.6 bits, see alignment E=4.3e-89

Best Hits

KEGG orthology group: K02015, iron complex transport system permease protein (inferred from 100% identity to dvu:DVU0649)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72EC9 at UniProt or InterPro

Protein Sequence (351 amino acids)

>DVU0649 iron compound ABC transporter, permease protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MSRIRRRTALALGAALWLLSVPAACLFGPFDIGPAEVMRLLGAAAGVPVSGHVDPIRLLV
VGDIRLARVCLSLLVGGGLAMAGVVFQGVLRNPLADPFTLGVSSGAALGASVAISFGVTL
PAAVAPALVAGLGVVTPAALFGAFAALSLVLLLGTAAGSFRRETVVLAGVVVSTFLAALV
SLVKALDEESVSSIVFWIMGSLQGRGWAHTAVLLPPLVLGLAAVVRHARDLDVLALGDTQ
ASQLGMRTGYVRCVLLCGASCITAGCVAVSGVIGFVGLVVPHLLRLVLGAAHGPLLIGAW
FGGGILLLWSDVVARTLLSGGAELPVGVVTALVGGPFFCLLLQREQRRERP