Protein Info for DVU0648 in Desulfovibrio vulgaris Hildenborough JW710

Name: fepC
Annotation: iron compound ABC transporter, ATP-binding protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00005: ABC_tran
  • amino acids 17 to 166 (150 residues), 97.1 bits, E=1.4e-31

Best Hits

Swiss-Prot: 43% identical to HMUV_MYXXD: Hemin import ATP-binding protein HmuV (hmuV) from Myxococcus xanthus (strain DK 1622)

KEGG orthology group: K02013, iron complex transport system ATP-binding protein [EC: 3.6.3.34] (inferred from 100% identity to dvu:DVU0648)

MetaCyc: 36% identical to ferric enterobactin ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-10-RXN [EC: 7.2.2.17]

Predicted SEED Role

"Vitamin B12 ABC transporter, ATPase component BtuD" in subsystem Coenzyme B12 biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.3.34 or 7.2.2.17

Sequence Analysis Tools

See Q72ED0 at UniProt or InterPro

Protein Sequence (271 amino acids)

>DVU0648 iron compound ABC transporter, ATP-binding protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MMECRALHAGYAQTEVLHGIDLRIAQDELVGLLGPNGSGKTTLLLALSGVLPARGGDVLL
DGTPLAAMAPRERARRIATVPQRPEVIPDVDAFSLVLMGRYPHTGPLRGYTAVDHDAAAA
ALAATGTAHLARRSAATLSGGELQRVLVARALAQDTDTLLLDEVTAGLDVARMVEVFDLL
AQRHRHGLRIVAAIHDINLAALYCTRLVFLKSGRVVLDGPVAQVFDEQALSAIYETRITV
HPHPVTGTPQASIVPGVGAAGVPHGAAHRAM