Protein Info for DVU0647 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: iron compound ABC transporter, periplasmic iron compount-binding protein, putative (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 304 PF01497: Peripla_BP_2" amino acids 31 to 268 (238 residues), 55.6 bits, see alignment E=2.6e-19

Best Hits

KEGG orthology group: K02016, iron complex transport system substrate-binding protein (inferred from 100% identity to dvl:Dvul_2313)

Predicted SEED Role

"Vitamin B12 ABC transporter, B12-binding component BtuF" in subsystem Coenzyme B12 biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72ED1 at UniProt or InterPro

Protein Sequence (304 amino acids)

>DVU0647 iron compound ABC transporter, periplasmic iron compount-binding protein, putative (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MLHTAPCEAAPVSCTDDTGTVITLEAPARRIIALYGAFNEILVEMGQSGRIVARTDADEA
IPALAGLPAIGTHMRPNPELVAGLAPDLILQMEGRREAATSVDALRALGIPVAVFRVASF
GDLFSVLHRMGTLTGAEQDAAALEARWTARLDTVAGAIARQPHDTGTADGKDHTQHPPRV
VFEVRYPNLLAAGADSIVNDIITRAGGVNAVQQPGRVVRLNEEELLRMAPDAYVYQYGPM
NPTPVAPDQRPHFTALDAIRDGRVLKVDEHAFSRPGPRSVEAVEQLARFLHPAAFDTNTT
TARN