Protein Info for DVU0646 in Desulfovibrio vulgaris Hildenborough JW710

Name: cobI
Annotation: precorrin-2 C20-methyltransferase (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 256 TIGR01467: precorrin-2 C(20)-methyltransferase" amino acids 4 to 232 (229 residues), 220 bits, see alignment E=1.4e-69 PF00590: TP_methylase" amino acids 5 to 214 (210 residues), 179.8 bits, see alignment E=3.6e-57

Best Hits

KEGG orthology group: K03394, precorrin-2/cobalt-factor-2 C20-methyltransferase [EC: 2.1.1.130 2.1.1.151] (inferred from 100% identity to dvl:Dvul_2314)

Predicted SEED Role

"Cobalt-precorrin-2 C20-methyltransferase (EC 2.1.1.130)" in subsystem Cobalamin synthesis or Coenzyme B12 biosynthesis (EC 2.1.1.130)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.130 or 2.1.1.151

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72ED2 at UniProt or InterPro

Protein Sequence (256 amino acids)

>DVU0646 precorrin-2 C20-methyltransferase (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MQPGTLYGIGVGPGAPDLLTLRAVSTLARVDVVFAAASSRNDYSVALDIARPHLRHDVTI
ERLDFPMTRDQSVLTAAWKANADAVEAVLRTGRNAAFLTLGDPLIYSTFGYLLRTLTALA
PDLPVEVIPGVTSYQAAAAKTRTILCESGENLLLLAGIQDAARLDTALTRADNAVILKAY
RNFSSIRTMLASHEATRDTVFVSRLGMEGEVVARDLHAAPEHPHYLSLLLVTDRKHGNPE
HTAESTSDAEADETAD