Protein Info for SO_A0154 in Shewanella oneidensis MR-1

Annotation: heavy metal efflux protein, putative (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 513 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details PF19335: HMBD" amino acids 63 to 89 (27 residues), 48 bits, see alignment (E = 2.9e-16) amino acids 146 to 173 (28 residues), 48.3 bits, see alignment (E = 2.3e-16) PF25919: BSH_CusB" amino acids 224 to 346 (123 residues), 57.5 bits, see alignment E=2.9e-19 TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 323 to 497 (175 residues), 106.9 bits, see alignment E=5.3e-35 PF25954: Beta-barrel_RND_2" amino acids 351 to 425 (75 residues), 69.6 bits, see alignment E=6.3e-23 PF25967: RND-MFP_C" amino acids 432 to 490 (59 residues), 34.2 bits, see alignment 6.1e-12 PF25975: CzcB_C" amino acids 435 to 494 (60 residues), 39.2 bits, see alignment E=1.6e-13

Best Hits

KEGG orthology group: None (inferred from 100% identity to son:SO_A0154)

Predicted SEED Role

"Probable Co/Zn/Cd efflux system membrane fusion protein" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8E807 at UniProt or InterPro

Protein Sequence (513 amino acids)

>SO_A0154 heavy metal efflux protein, putative (NCBI) (Shewanella oneidensis MR-1)
MNQFNTVKKQAPKAVLILSSLLISTPWLSHAQLANTQEHTATEAAANSATAPKNNLLNQV
KTYTCPMHPEVISHELGRCPKCNMFLVEKLDASNPAAEHAQHQAADHQTSEHGHTSAAKA
ASQVFDTPTPKADSLVKAQNNETTIKYVCPMHTHIISDVPGTCPICGMNLEKVETGGNTQ
EININVSGSMQQALALKVAKVERDTLWKFVETVGQIDYDESQITHIHARVTGWIEKLMLK
SVGDTVKKDQLIYEIYSPDLINAQDDYLLAMDTAKANGQGRYKDLVRNAGLRLSFLGFND
RQIKQLAESHQTQYRVPFYAKEDGIVKALDIRDGMYIQPSTEVMSVVDLSKVWVIADVFE
NEQSWIAKGQKAEIAVPAMNISGIEGTIDYIYPELDPVTRSLRVRVVLNNTEVDLRPKTL
AKVSLFGGPNKDVLVIPQEALIQTGKENRVIVKQTDDSFTAKAVTVGMMSQGKAEIISGL
NEGERVVISGQFLLDSEASLKGSLMRLSSGHQH