Protein Info for SOA0091 in Shewanella oneidensis MR-1

Annotation: ISSod1, transposase OrfB (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 269 PF13276: HTH_21" amino acids 25 to 76 (52 residues), 39.6 bits, see alignment 1e-13 PF00665: rve" amino acids 104 to 201 (98 residues), 99.7 bits, see alignment E=2e-32 PF13683: rve_3" amino acids 189 to 255 (67 residues), 49 bits, see alignment E=8.4e-17 PF13333: rve_2" amino acids 208 to 261 (54 residues), 41.5 bits, see alignment E=2.4e-14

Best Hits

Swiss-Prot: 39% identical to INSF3_ECOLI: Transposase InsF for insertion sequence IS3C (insF3) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to son:SO_1904)

Predicted SEED Role

"Mobile element protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (269 amino acids)

>SOA0091 ISSod1, transposase OrfB (NCBI ptt file) (Shewanella oneidensis MR-1)
MSVSKSGYYDWHKRPANVISVETLKLYRLVRQLFKQSRGSLGNREMVKKLRKEGYQVGRY
LVRKIMHRLRLKATQRCAYKVTTQRKHSDAVADNLLNMNFNPVSANQVWAGDVTYLKTGE
GWMYLAVVMDLYSRRIVGWRIDKRMTTDLISKALIKAYNLRQPARGLVFHSDRGSQYTSK
QFGRLLSSYGIRASMGDVGACWDNAVVERFFGSLKHDWIFKVAQPTREFMKQDVTAYIKY
YNLERLHSANNDLSPVEFENSQVKVSSLG