Protein Info for SOA0048 in Shewanella oneidensis MR-1

Annotation: prolyl oligopeptidase family protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 642 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details PF02129: Peptidase_S15" amino acids 396 to 537 (142 residues), 24.3 bits, see alignment E=8.7e-09 PF20434: BD-FAE" amino acids 406 to 599 (194 residues), 51.4 bits, see alignment E=3.8e-17 PF00561: Abhydrolase_1" amino acids 415 to 526 (112 residues), 27.5 bits, see alignment E=8.8e-10 PF12146: Hydrolase_4" amino acids 416 to 531 (116 residues), 32.2 bits, see alignment E=2.5e-11 PF01738: DLH" amino acids 430 to 629 (200 residues), 39.2 bits, see alignment E=2.2e-13 PF00326: Peptidase_S9" amino acids 430 to 640 (211 residues), 174 bits, see alignment E=1.1e-54 PF00756: Esterase" amino acids 493 to 603 (111 residues), 25.4 bits, see alignment E=4.1e-09

Best Hits

KEGG orthology group: None (inferred from 100% identity to son:SO_A0048)

Predicted SEED Role

"prolyl oligopeptidase family protein" in subsystem Synechocystis experimental

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8E875 at UniProt or InterPro

Protein Sequence (642 amino acids)

>SOA0048 prolyl oligopeptidase family protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MKIHLFYKEVIVILKVLLISIFFSFSIQAVTINDFSRHPEFYDVKISPDGKYLATLVNTE
GRKTLAFLDSDTFKVIFALGGDKRDQVADYYWVNNERVIVQVEQVRGSLEKPLNYGEIYA
VNFDGKKGAMIYGYRAKTPTSNGGFLVDNLKGDDQHVLIRSQALSRRTDVIPEIVKLNIY
SGKTRRIKRAPLAYSQFLIDHAGVPRFVAGTDDKFTTQLYYSKGQGDDWQLFGDKFAGAF
EPIAFAADNQSIYALKSTDDGPKGLYHYDLSTKKETKLYQSEMVDPTYAIGSQLNEVYGL
RIDEDYPNYLYLKPDSVDAKLHKSLVDAFNGDSVLVSSITEDGKQAIVHVSSDRNPGDFY
LFDTTQMKARFLMSSRGWINAKEMAETEPFRIKTKDGFTLNGLMTLPKDKKTNLPTVILP
HGGPHARDYWGFDPLVQMLANQGFAVVQVNFRGSTGYGKNFEEAGYGKWGTKIQDDIMLA
TQYAIQQGIADENRMCILGISFGGYSALQSATRYPDTFKCAIGYAGVYDLEMLYNEGDVK
DTSWGDAYLDKTLGTDKAALKSQSPVHFVDMLKASVLIIHGEEDKRASIEHANALMKALD
KANIPYEKLIKDKEGHGFYKQENIGEANKKIVDFLNRKIGFK